PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN32523.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 319aa    MW: 36163.5 Da    PI: 5.9249
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN32523.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++   g+ R+ k+c++rw +yl
       KHN32523.1 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNTGLMRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.52.1e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T  E++ ++++ ++lG++ W++Ia++++  Rt++++k++w+++l
       KHN32523.1  67 RGNFTDHEEKMIIHLQALLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.8E-24564IPR009057Homeodomain-like
PROSITE profilePS5129425.334965IPR017930Myb domain
SuperFamilySSF466892.37E-3011108IPR009057Homeodomain-like
SMARTSM007172.1E-131363IPR001005SANT/Myb domain
PfamPF002495.5E-161461IPR001005SANT/Myb domain
CDDcd001676.64E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129419.21666116IPR017930Myb domain
SMARTSM007174.0E-1566114IPR001005SANT/Myb domain
PfamPF002498.1E-1467112IPR001005SANT/Myb domain
CDDcd001672.76E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGRPPCCDKI GIKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGLMRCS KSCRLRWTNY  60
LRPGIKRGNF TDHEEKMIIH LQALLGNRWA AIASYLPQRT DNDIKNYWNT HLKKKLKKMQ  120
SGSDDDDNND DKLNSCNSQI KGQWERRLQT DIHMAKQALC EALSLDKPTQ IFPETKLPST  180
SSHNPTTTPN QTSLYASSTE NIAKLLENWM KKSPNITTIT ETKPFNINNM VATGSSSSEG  240
TQSTITCTQD HALDSLWSFN SERSCQSEEN TNLGESKPQY QEAQVPLMLL ENWLFDDAAP  300
QCNEDLMNMS LEESTEGLF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-251211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00395DAPTransfer from AT3G47600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKC7591580.0KC759158.1 Glycine max transcription factor MYBJ2 (MYBJ2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001242312.10.0myb-related protein 306-like
SwissprotP813921e-121MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0B2RKN40.0A0A0B2RKN4_GLYSO; Myb-related protein 306
STRINGGLYMA04G33720.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47600.11e-109myb domain protein 94
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]